ERBB3 anticorps

N° du produit ABIN2779309

L’anticorps Lapin Polyclonal anti-ERBB3 a été validé pour IHC. Il convient pour détecter ERBB3 dans des échantillons de Humain, Souris, Rat, Boeuf (Vache), Cheval et Cobaye.

Aperçu rapide pour ERBB3 anticorps (ABIN2779309)

Antigène: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cheval, Cobaye

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERBB3 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-ERBB3 anticorps

Séquence: GLLFSLARGS EVGNSQAVCP GTLNGLSVTG DAENQYQTLY KLYERCEVVM

Homologie: Cow: 92%, Guinea Pig: 100%, Horse: 92%, Human: 100%, Mouse: 92%, Rat: 92%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM

Information d'application

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeat freeze-thaw cycles.

Stock: -20 °C

Stockage commentaire: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Détails sur ERBB3

Antigène: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Autre désignation: ERBB3

Sujet: This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Alias Symbols: HER3, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3,
Protein Interaction Partner: PA2G4, UBC, NEDD4, JAK3, JAK2, ITK, HSP90AA1, HCK, GRB7, FGFR1, FER, PIK3R2, PIK3R1, NCK1, SH2D1A, TNS4, TNS3, SHC3, DAPP1, TENC1, VAV3, SH2B3, RIN1, PIK3R3, NCK2, BCAR3, ZAP70, VAV2, VAV1, TXK, SYK, SRC, SHC1, RASA1, PTK6, PLCG1, DAB1, CRKL, CRK, CHN2, A
Protein Size: 1342

Poids moléculaire: 148 kDa

ID gène: 2065

NCBI Accession: NM_001005915, NP_001973

UniProt: P21860

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway